Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: VFLQQQCSPVPMPQR
Peptide within the protein Barley-gluten-Q4G3S5:
MKTFLIFALLAIAATNTIAQQQPFPQQPQPYPQQPQPYPQQPFPPQQPFPQQPPFWWQQPVQSQQQPCQQQQTPLPQGQQYQPLPQQQIPLVHPSVLQQLNPCKVFLQQQCSPVPMPQRIARSQMLQQSSCHVLQQQCCQQLPQIPEQFRHEAIRAIIYSIILQEQQQVQDFVQPQQQQPQQSVQGVSQSQQQSQQPQLGQCSFQQPQLQQLGQQQQVPQGAFLQPQQMAQLEVMTSVALRTLPTMCNVNVPLYGITTSVPLSVGTGVGPY
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide VFLQQQCSPVPMPQR are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Elymus spicatus | Elymus spicatus | AHY86055 |
4604 |
| Hordeum bulbosum subsp. bulbosum | Hordeum bulbosum subsp. bulbosum | ALA63864 |
1608635 |
| Hordeum chilense | Hordeum chilense | AAW34171 AAW34180 AAY44809 AAW34183 AAW34184 AAW34187 AAW34186 AAW34185 AAW34189 |
15565 |
| Hordeum marinum subsp. gussoneanum | Hordeum marinum subsp. gussoneanum | ALA63865 |
98114 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.